FAM129A antibody
Ref. 3D-70R-1294
100µl | 697,00 € |
Produktinformation
FAM129A antibody was raised using the N terminal of FAM129A corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-1294 FAM129A antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.