ALOX15B antibody
Ref. 3D-70R-1635
100µl | 697,00 € |
Produktinformation
ALOX15B antibody was raised using the C terminal of ALOX15B corresponding to a region with amino acids ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-1635 ALOX15B antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.