SC4MOL antibody
Ref. 3D-70R-1734
100µl | 697,00 € |
Produktinformation
SC4MOL antibody was raised using the N terminal of SC4MOL corresponding to a region with amino acids MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-1734 SC4MOL antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.