CLCC1 antibody
Ref. 3D-70R-1789
100µl | 697,00 € |
Produktinformation
CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETW
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-1789 CLCC1 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.