![discount label](https://static.cymitquimica.com/public/img/discount.png)
ST6GALNAC5 antibody
Ref. 3D-70R-1903
100µl | 710,00 € |
Produktinformation
ST6GALNAC5 antibody was raised using the middle region of ST6GALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-1903 ST6GALNAC5 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.