TPH2 antibody
Ref. 3D-70R-2005
100µl | 762,00 € |
Produktinformation
TPH2 antibody was raised using the middle region of TPH2 corresponding to a region with amino acids KMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-2005 TPH2 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.