Crystallin Gamma C antibody
Ref. 3D-70R-2030
100µl | 762,00 € |
Produktinformation
Crystallin Gamma C antibody was raised using the middle region of CRYGC corresponding to a region with amino acids GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-2030 Crystallin Gamma C antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.