PIP4K2A antibody
Ref. 3D-70R-2708
100µl | 762,00 € |
Produktinformation
PIP4K2A antibody was raised using the N terminal of PIP4K2A corresponding to a region with amino acids IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-2708 PIP4K2A antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.