KLHDC1 antibody
Ref. 3D-70R-2991
100µl | 762,00 € |
Produktinformation
KLHDC1 antibody was raised using the N terminal of KLHDC1 corresponding to a region with amino acids IDSGLWRMHLMEGELPASMSGSCGACINGKLYIFGGYDDKGYSNRLYFVN
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-2991 KLHDC1 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.