PLAC9 antibody
Ref. 3D-70R-3519
100µl | 762,00 € |
Produktinformation
PLAC9 antibody was raised using the middle region of PLAC9 corresponding to a region with amino acids RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-3519 PLAC9 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.