![discount label](https://static.cymitquimica.com/public/img/discount.png)
GDAP2 antibody
Ref. 3D-70R-3977
100µl | 775,00 € |
Produktinformation
GDAP2 antibody was raised using the N terminal of GDAP2 corresponding to a region with amino acids CRTGEAKLTKGFNLAARFIIHTVGPKYKSRYRTAAESSLYSCYRNVLQLA
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-3977 GDAP2 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.