C1orf104 antibody
Ref. 3D-70R-3998
100µl | 762,00 € |
Produktinformation
C1orf104 antibody was raised using the middle region of C1orf104 corresponding to a region with amino acids APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-3998 C1orf104 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.