![discount label](https://static.cymitquimica.com/public/img/discount.png)
C1orf144 antibody
Ref. 3D-70R-4008_B
Unbestimmte Größe | Nachfragen |
Produktinformation
C1orf144 antibody was raised using the N terminal of C1orf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-4008_B C1orf144 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.