PM20D2 antibody
Ref. 3D-70R-4116
100µl | 762,00 € |
Produktinformation
PM20D2 antibody was raised using the middle region of PM20D2 corresponding to a region with amino acids HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-4116 PM20D2 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.