![discount label](https://static.cymitquimica.com/public/img/discount.png)
TBC1D14 antibody
Ref. 3D-70R-4318
100µl | 775,00 € |
Produktinformation
TBC1D14 antibody was raised using the N terminal of TBC1D14 corresponding to a region with amino acids MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-4318 TBC1D14 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.