Carbonic Anhydrase Vb antibody (Mitochondrial)
Ref. 3D-70R-4459
100µl | 762,00 € |
Produktinformation
Carbonic Anhydrase Vb antibody (Mitochondrial) was raised using the N terminal of CA5B corresponding to a region with amino acids WRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-4459 Carbonic Anhydrase Vb antibody (Mitochondrial)
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.