C16orf73 antibody
Ref. 3D-70R-4561
100µl | 762,00 € |
Produktinformation
C16orf73 antibody was raised using the middle region of C16orf73 corresponding to a region with amino acids CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-4561 C16orf73 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.