C8orf45 antibody
Ref. 3D-70R-4564
100µl | 762,00 € |
Produktinformation
C8orf45 antibody was raised using the middle region of C8orf45 corresponding to a region with amino acids IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-4564 C8orf45 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.