ApoBEC3F antibody
Ref. 3D-70R-4815
100µl | 762,00 € |
Produktinformation
ApoBEC3F antibody was raised using the middle region of APOBEC3F corresponding to a region with amino acids MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQ
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-4815 ApoBEC3F antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.