![discount label](https://static.cymitquimica.com/public/img/discount.png)
UBE3A antibody
Ref. 3D-70R-5247
100µl | 775,00 € |
Produktinformation
UBE3A antibody was raised using the middle region of Ube3A corresponding to a region with amino acids AKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGML
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-5247 UBE3A antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.