![discount label](https://static.cymitquimica.com/public/img/discount.png)
Chymotrypsin-Like antibody
Ref. 3D-70R-5436
100µl | 775,00 € |
Produktinformation
Chymotrypsin-Like antibody was raised using the N terminal of CTRL corresponding to a region with amino acids SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-5436 Chymotrypsin-Like antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.