MAPK12 antibody
Ref. 3D-70R-5682
100µl | 762,00 € |
Produktinformation
MAPK12 antibody was raised using the N terminal of MAPK12 corresponding to a region with amino acids SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-5682 MAPK12 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.