![discount label](https://static.cymitquimica.com/public/img/discount.png)
GADD45B antibody
Ref. 3D-70R-5930
100µl | 775,00 € |
Produktinformation
GADD45B antibody was raised using the middle region of GADD45B corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-5930 GADD45B antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.