![discount label](https://static.cymitquimica.com/public/img/discount.png)
ADRB1 antibody
Ref. 3D-70R-5939
100µl | 775,00 € |
Produktinformation
ADRB1 antibody was raised using the middle region of ADRB1 corresponding to a region with amino acids CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-5939 ADRB1 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.