PCDHAC1 antibody
Ref. 3D-70R-6120
100µl | 762,00 € |
Produktinformation
PCDHAC1 antibody was raised using the N terminal of PCDHAC1 corresponding to a region with amino acids RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-6120 PCDHAC1 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.