MMP23B antibody
Ref. 3D-70R-6358
100µl | 762,00 € |
Produktinformation
MMP23B antibody was raised using the N terminal of MMP23B corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-6358 MMP23B antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.