SLC35E2 antibody
Ref. 3D-70R-6754
100µl | 775,00 € |
Produktinformation
SLC35E2 antibody was raised using the middle region of SLC35E2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-6754 SLC35E2 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.