![discount label](https://static.cymitquimica.com/public/img/discount.png)
PI3 antibody
Ref. 3D-70R-7380
100µl | 775,00 € |
Produktinformation
PI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQV
Chemische Eigenschaften
Technische Anfrage zu: 3D-70R-7380 PI3 antibody
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.