
LL-37 acid
Ref. 3D-CRB1000007
1mg
470,00€
500µg
386,00€

Produktinformation
Name:LL-37 acid
Synonyme:
- H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OHhCAP18LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-acidH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-L ys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln -Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OHhCAP18
Marke:Biosynth
Beschreibung:LL-37, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide. LL-37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. LL-37 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes.
LL-37 plays an important role in the first act of defense against local infection and systemic invasion of pathogens at sites of inflammation.
LL-37 shows cytotoxicity against bacterial and normal eukaryotic cells and is significantly resistant to proteolytic degradation. Besides its antimicrobial functions, LL-37 also has immunomodulatory roles. LL-37 suppresses the production of pro-inflammatory cytokines, TNF-α and IL-6 in infected monocytes. LL-37 increases cytokine and chemokine liberation from local cells and leucocytes and has chemotactic effects on a large number of immune cells.
LL-37 plays an important role in the first act of defense against local infection and systemic invasion of pathogens at sites of inflammation.
LL-37 shows cytotoxicity against bacterial and normal eukaryotic cells and is significantly resistant to proteolytic degradation. Besides its antimicrobial functions, LL-37 also has immunomodulatory roles. LL-37 suppresses the production of pro-inflammatory cytokines, TNF-α and IL-6 in infected monocytes. LL-37 increases cytokine and chemokine liberation from local cells and leucocytes and has chemotactic effects on a large number of immune cells.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.
Chemische Eigenschaften
Molekulargewicht:4,490.6 g/mol
Technische Anfrage zu: LL-37 acid
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.