
ACTH (1-39) Human
Ref. 3D-CRB1000076
1mg
470,00€
500µg
386,00€

Produktinformation
Name:ACTH (1-39) Human
Synonyme:
- H-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OHAdrenocorticotropic hormone (1-39)SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-acidH-Ser-T yr-Ser-Met-Glu-His-P he-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-A sn-Gly-Ala-Glu-Asp-Glu-Ser-A
Marke:Biosynth
Beschreibung:Human adrenocorticotropic hormone (ACTH) also known as corticotropin. ACTH is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.
Chemische Eigenschaften
Molekulargewicht:4,541.07 g/mol
Farbe/Form:Powder
Technische Anfrage zu: ACTH (1-39) Human
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.