CymitQuimica logo

beta-Amyloid (1-40) Human

Ref. 3D-CRB1000087

1mg
588,00€
5mg
1.866,00€
100µg
349,00€
500µg
477,00€
beta-Amyloid (1-40) Human
Biosynth

Produktinformation

Name:beta-Amyloid (1-40) Human
Synonyme:
  • H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHAbeta 1-40
Marke:Biosynth
Beschreibung:Amyloid β-peptide (Aβ) has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD.Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS.Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Aβ1-40 is a major C terminal variant of amyloid β constituting the most abundant AB peptide in the human brain.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.

Chemische Eigenschaften

Molekulargewicht:4,329.8 g/mol

Technische Anfrage zu: beta-Amyloid (1-40) Human

Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern

Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.
◻️
CYMIT QUÍMICA, S.L. wird Ihre Daten behandeln, um auf Ihre Fragen oder Anfragen zu antworten. Sie können auf Ihre Daten zugreifen, sie berichtigen und löschen sowie andere Rechte ausüben, indem Sie die zusätzlichen und detaillierten Informationen zum Datenschutz in unserer Web-Datenschutzerklärung lesen.
* Obligatorische felder.