Exendin 4 (4-39)

Ref. 3D-CRB1000423

Produktinformation

• Name: Exendin 4 (4-39)
• Synonyme: H-GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2GTFTSDLSKQMEEEAVRLFIE-W-LKNGGPSSGAPPPS-amideH-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Me t-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-T rp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Beschreibung

This is a truncated exendin-4 peptide, the original peptide was identified in Gila monster lizard (Heloderma suspectum). Exendin-4 is an incretin mimetic, an analog of glucagon-like-peptide-1 (GLP-1), it stimulates insulin secretion and modulates gastric emptying to slow the entry of ingested sugars into the bloodstream. Exendin-4 is resistant to cleavage by plasma DPP-IV unlike GLP-1. This gives it a longer half-life and duration of action than GLP-1, as well as greater potency in vivo. Exendin-4 increases insulin sensitivity and improves glucose tolerance and is currently used for the treatment of Type 2 diabetes mellitus in its synthetic form Exenatide.Exendin-4 also promotes the production and proliferation of β-cells leading to regeneration of the pancreas. It is a ligand to the exendin receptor and increases pancreatic acinar cell cAMP levels. However, the GLP-1 analog was found to have a toxic effect by inducing hypotension due to relaxation of the cardiac smooth muscle.

• Marke: Biosynth

Chemische Eigenschaften

• Molekulargewicht: 3,860.9 g/mol
• Farbe/Form: Powder