CymitQuimica logo

GIP (1-42)-[C] human

Ref. 3D-CRB1000509

1mg
Ausgelaufen
100µg
Ausgelaufen
500µg
Ausgelaufen

Ausgelaufenes Produkt. Für Anfragen zu ähnlichen Produkten verwenden Sie bitte unser Anfrageformular oder senden Sie uns eine E-Mail an .

GIP (1-42)-[C] human
Biosynth

Produktinformation

Name:GIP (1-42)-[C] human
Synonyme:
  • H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQC-NH2
Marke:Biosynth
Beschreibung:Peptide derived from the Gastric inhibitory polypeptide (GIP), an inhibiting hormone of the secretin family of hormones. While GIP is a weak inhibitor of gastric acid secretion, its main role is to stimulate insulin secretion - in a glucose-dependent mechanism. Therefore, GIP is referred to as a glucose-dependent insulinotropic peptide.GIP is derived from a 153-amino acid pro-protein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. It is synthesised by K cells, which are found in the mucosa of the duodenum and the jejunum of the gastrointestinal tract. GIP receptors are seven-transmembrane proteins found on β-cells in the pancreas. These β-cells are those that are able to simultaneously detect glucose and release insulin as a result to GIP binding.The clinical relevance of GIP is related to type 2 diabetes mellitus (T2DM)- studies have found that T2DM diabetics are unresponsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In research involving knockout mice, it was found that absence of the GIP receptors correlates with resistance to obesity.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.

Chemische Eigenschaften

Molekulargewicht:1,234.5 g/mol

Anfrage zum ausgelaufenen Produkt: GIP (1-42)-[C] human

◻️
CYMIT QUÍMICA, S.L. wird Ihre Daten behandeln, um auf Ihre Fragen oder Anfragen zu antworten. Sie können auf Ihre Daten zugreifen, sie berichtigen und löschen sowie andere Rechte ausüben, indem Sie die zusätzlichen und detaillierten Informationen zum Datenschutz in unserer Web-Datenschutzerklärung lesen.
* Obligatorische felder.