CymitQuimica logo

GIP (Pro 3)

Ref. 3D-CRB1000715

1mg
470,00€
500µg
386,00€
GIP (Pro 3)
Biosynth

Produktinformation

Name:GIP (Pro 3)
Synonyme:
  • H-YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-NH2(Pro3) Gastric Inhibitory Peptide
Marke:Biosynth
Beschreibung:Gastric inhibitory polypeptide (GIP) is an inhibiting hormone of the secretin family of hormones. While GIP is a weak inhibitor of gastric acid secretion, its main role is to stimulate insulin secretion - in a glucose-dependent mechanism. Therefore, GIP is referred to as a glucose-dependent insulinotropic peptide. In GIP (Pro 3) the glutamic acid at position 3 has been substituted for a proline.GIP is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. It is synthesised by K cells, which are found in the mucosa of the duodenum and the jejunum of the gastrointestinal tract. GIP receptors are seven-transmembrane proteins found on β-cells in the pancreas. These β-cells are those that are able to simultaneously detect glucose and release insulin as a result to GIP binding.The clinical relevance of GIP is related to type 2 diabetes mellitus (T2DM)- studies have found that T2DM diabetics are unresponsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In research involving knockout mice, it was found that absence of the GIP receptors correlates with resistance to obesity.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.

Chemische Eigenschaften

Molekulargewicht:4,947.5 g/mol

Technische Anfrage zu: GIP (Pro 3)

Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern

Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.
◻️
CYMIT QUÍMICA, S.L. wird Ihre Daten behandeln, um auf Ihre Fragen oder Anfragen zu antworten. Sie können auf Ihre Daten zugreifen, sie berichtigen und löschen sowie andere Rechte ausüben, indem Sie die zusätzlichen und detaillierten Informationen zum Datenschutz in unserer Web-Datenschutzerklärung lesen.
* Obligatorische felder.