CymitQuimica logo

LL-37 amide

CAS:

Ref. 3D-CRB1000864

500µg
386,00€
1mg
470,00€
LL-37 amide
Biosynth

Produktinformation

Name:LL-37 amide
Synonyme:
  • H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-amideH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Gl u-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gl n-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
Marke:Biosynth
Beschreibung:LL-37 is a member of the large cationic family of anti-microbial peptides called cathelicidins which have broad-spectrum anti-microbial activity and are expressed in many species. The only cathelicidin found in humans is LL-37, this is produced in epithelial cells, by proteolytic cleavage from the C-terminal of the hCAP-18 protein. LL-37 can be processed into different forms of anti-microbial peptides. As well as its anti-microbial properties LL-37 also regulates many aspects of the innate immune system and overexpression of LL-37 has been linked to autoimmune diseases such as asthma and psoriasis, making LL-37 the most studied form of the human cathelicidin peptides.More recently, studies have shown that LL-37 binds to SARS-CoV-2 S protein and inhibits binding to its receptor hACE2, which may inhibit viral entry into the cell. LL-37 is upregulated by vitamin D, therefore this may be one mode of action for the positive outcomes seen with vitamin D treatment for Covid-19.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.

Chemische Eigenschaften

Molekulargewicht:4,493.3 g/mol
Formel:C205H341N61O52

Technische Anfrage zu: LL-37 amide

Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern

Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.
◻️
CYMIT QUÍMICA, S.L. wird Ihre Daten behandeln, um auf Ihre Fragen oder Anfragen zu antworten. Sie können auf Ihre Daten zugreifen, sie berichtigen und löschen sowie andere Rechte ausüben, indem Sie die zusätzlichen und detaillierten Informationen zum Datenschutz in unserer Web-Datenschutzerklärung lesen.
* Obligatorische felder.