CymitQuimica logo

CRF human, rat

Ref. 3D-CRB1000985

1mg
477,00€
500µg
254,00€
CRF human, rat
Biosynth

Produktinformation

Name:CRF human, rat
Synonyme:
  • H-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-amideH-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-As p-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Gl
Marke:Biosynth
Beschreibung:The peptide CRF, also known as the Corticotropin Releasing Factor is a 14 amino acid neuropeptide which is produced by the hypothalamus, within the hypothalamic-pituitary adrenal axis in response to stress stimuli. The CRF family exert their function by binding to Corticotropin-releasing factor receptors 1 and 2. During stress the production of CRF stimulates downstream hormones such as glucocorticoids and adrenocorticotropin (ACTH) through binding to CRF1 in the anterior pituitary gland. A negative feedback look is generated through glucocorticoids thus preventing the further release of CRF from the hypothalamus.Studies have shown CRF to be overproduced in patients with depression and can contribute to symptoms such as, reduced quality of sleep, anxiety, reduced appetite and analgesia. Furthermore higher CRF levels has been associated with immune cell dysfunction through preventing T-cell proliferation.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.

Chemische Eigenschaften

Molekulargewicht:4,754.5 g/mol
Farbe/Form:Powder

Technische Anfrage zu: CRF human, rat

Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern

Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.
◻️
CYMIT QUÍMICA, S.L. wird Ihre Daten behandeln, um auf Ihre Fragen oder Anfragen zu antworten. Sie können auf Ihre Daten zugreifen, sie berichtigen und löschen sowie andere Rechte ausüben, indem Sie die zusätzlichen und detaillierten Informationen zum Datenschutz in unserer Web-Datenschutzerklärung lesen.
* Obligatorische felder.