Cecropin-B

CAS: 80451-05-4

Ref. 3D-CRB1001130

Produktinformation

• Name: Cecropin-B
• Synonyme: H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala- Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Ly s-Ala-Leu-NH2CEF20, Cytomegalovirus, CMV pp65 (495-503), H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2

Beschreibung

Cecropins are a lytic peptide family, originally isolated from Hyalophora cecropia. Cecropin-B is a cationic helical peptide that can form pores, this is believed to be the reason for its such potent lytic activity. Cecropin-B has been shown to be effective against both Gram-positive and Gram-negative bacteria plus numerous cancer cell lines including multidrug-resistant types. The ability to insert into the cell membrane and lead to pore formation is attributed to the amphipathic groups present creating amphipathic regions. The effectiveness of cecropin-B on cancer cells has led to further use of the peptide as a model for potential new anticancer drugs including cyclic cationic forms.

• Marke: Biosynth

Chemische Eigenschaften

• Molekulargewicht: 3,832.3 g/mol
• Farbe/Form: Powder