Amyloid beta-Protein (1-38) trifluoroacetate salt

CAS: 131438-74-9

Ref. 3D-FA108828

Produktinformation

• Name: Amyloid beta-Protein (1-38) trifluoroacetate salt
• Synonyme: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe- Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-OH H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG-OH
• Marke: Biosynth
• Beschreibung: Please enquire for more information about Amyloid beta-Protein (1-38) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Chemische Eigenschaften

• Molekulargewicht: 4,131.54 g/mol
• Formel: C₁₈₄H₂₇₇N₅₁O₅₆S
• Reinheit: Min. 95%