(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt

CAS: 1816939-33-9

Ref. 3D-FA110203

Produktinformation

• Name: (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
• Synonyme: H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe -Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-G ly-Leu-Met-Val-Gly-Gly-Val-Val-OH H-DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH
• Marke: Biosynth
• Beschreibung: Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Chemische Eigenschaften

• Molekulargewicht: 4,348.85 g/mol
• Formel: C₁₉₄H₃₀₀N₅₄O₅₈S
• Reinheit: Min. 95%