Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
CAS: 133551-97-0
Ref. 3D-FB110162
10mg | 1.739,00 € | ||
25mg | 2.319,00 € | ||
50mg | 2.898,00 € | ||
100mg | 4.057,00 € | ||
250mg | 5.797,00 € |
Produktinformation
- H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Big endothelin-3 is a peptide that is a potent inhibitor of the endothelin receptor. It has been shown to inhibit the binding of endothelin to its receptors and antagonize the effects of endothelin on cells. Big endothelin-3 is a research tool for studying protein interactions, activators, and ligands. This product is the ammonium acetate salt form.
Chemische Eigenschaften
Technische Anfrage zu: 3D-FB110162 Big Endothelin-3 (1-41) amide (human) trifluoroacetate salt
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.