5-Bromopicolinamide
CAS: 90145-48-5
Ref. 3D-FB153951
1g | Nachfragen | |
2g | Nachfragen | |
5g | Nachfragen | |
10g | Nachfragen | |
500mg | Nachfragen |
Produktinformation
- 2-Pyridinecarboxamide, 5-Bromo-
5-Bromopicolinamide is a matrix-assisted laser desorption/ionization (MALDI) proteolytic peptide. It has been shown to be effective at cleaving myoglobin, which is an important part of the muscle protein that stores oxygen for use during exercise. 5-Bromopicolinamide is also able to detect the presence of phosphorylation sites on proteins. This compound is used as a substrate in MALDI mass spectrometry and has been successfully applied to the identification of phosphorylation sites on myoglobin and other proteins. The amino acid sequence of this compound has also been determined and annotated in databases such as UniProtKB/Swiss-Prot and NCBI Protein database.br>br>
br>
Sequences:
br>br>
METDVVELLHLEQLAQERELKLNVEGAEAVAKRRKDGLATTVSPSNTPGGGGRL
Chemische Eigenschaften
Technische Anfrage zu: 3D-FB153951 5-Bromopicolinamide
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.