Gastric Inhibitory Polypeptide (1-30) amide (porcine)
CAS: 134846-93-8
Ref. 3D-FG109097
1mg | 514,00 € | ||
2mg | 843,00 € | ||
5mg | 1.714,00 € | ||
250µg | 204,00 € | ||
500µg | 336,00 € |
Produktinformation
- H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln- Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH2 H-YA EGTFISDYSIAMDKIRQQDFVNWLLAQK-NH2
Please enquire for more information about Gastric Inhibitory Polypeptide (1-30) amide (porcine) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemische Eigenschaften
Technische Anfrage zu: 3D-FG109097 Gastric Inhibitory Polypeptide (1-30) amide (porcine)
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.