PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt

CAS: 124123-15-5

Ref. 3D-FP110313

Produktinformation

• Name: PACAP-38 (human, mouse, ovine, porcine, rat) trifluoroacetate salt
• Synonyme: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln -Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-G ln-Arg-Val-Lys-Asn-Lys-NH2 H-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
• CAS: 124123-15-5

Beschreibung

PACAP-38 is a peptide that has been shown to have a variety of physiological effects, including the regulation of brain functions and immunological responses. PACAP-38 has been found to bind to toll-like receptor 4 (TLR4) in macrophages and neutrophils, which stimulates the production of proinflammatory cytokines. It also interacts with adenylate cyclase, which leads to an increase in cAMP levels. This may be the mechanism by which PACAP-38 regulates brain functions. The biological function of PACAP-38 is not yet clear but it may act as a signal peptide, regulating protein synthesis and gene expression.

• Marke: Biosynth

Chemische Eigenschaften

• Molekulargewicht: 4,534.26 g/mol
• Formel: C₂₀₃H₃₃₁N₆₃O₅₃S
• Reinheit: Min. 95%