Peptide YY (human) trifluoroacetate salt

CAS: 118997-30-1

Ref. 3D-FP110394

Produktinformation

• Name: Peptide YY (human) trifluoroacetate salt
• Synonyme: H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Ar g-Gln-Arg-Tyr-NH2 H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2

Beschreibung

Peptide YY (PYY) is a 36-amino acid peptide that is secreted by the gut. PYY is a potent inhibitor of food intake and glucose homeostasis in rats and may be involved in the regulation of lipid metabolism. The trifluoroacetate salt form of PYY has been shown to have improved solubility, stability, and bioavailability. It has also been found to be more selective for the PYY receptor than other forms of PYY. The trifluoroacetate salt form of PYY remains stable to phase chromatography under acidic conditions but degrades at higher pH levels.

• Marke: Biosynth

Chemische Eigenschaften

• Molekulargewicht: 4,309.75 g/mol
• Formel: C₁₉₄H₂₉₅N₅₅O₅₇
• Reinheit: Min. 95%