OD1 Toxin

Ref. 3D-ODT-3866-PI

Produktinformation

• Name: OD1 Toxin
• Synonyme: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2H-Gly-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr- Thr-Cys-Ala-Ser-Asn-Gly-Tyr-Cys-Asn-Thr-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Gl u-Ser-Gly-Tyr-Cys-Gln-Trp-Ile-Gly-Arg-Tyr-Gly-Asn-A
• Marke: Biosynth
• Beschreibung: OD1 toxin is a peptide that belongs to the scorpion family. It is a potent activator of voltage-gated sodium channels and has been shown to be effective in the treatment of pain, inflammation, and other neurological disorders. OD1 toxin also has the ability to regulate the release of neurotransmitters in the central nervous system. The peptides are produced by Odonthobuthus doriae and are structurally rich in disulfide bonds. These molecules have been shown to act as channel activators, which bind to voltage-gated sodium channels at depolarized membrane potentials, increasing neuronal excitability and triggering action potentials.

Chemische Eigenschaften

• Molekulargewicht: 7,206.21 g/mol
• Formel: C₃₀₈H₄₆₆N₉₀O₉₅S₈
• Reinheit: Min. 95%