
Big Endothelin-3 (Human, 1-41 Amide) Acetate
CAS:
Ref. 3D-PED-3739-PI
1mg
1.984,00€
5mg
Nachfragen
100µg
499,00€

Produktinformation
Name:Big Endothelin-3 (Human, 1-41 Amide) Acetate
Synonyme:
- [Cyc(1,15)(3,11)]H-CTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFR-NH2
Marke:Biosynth
Beschreibung:Big Endothelin-3 (Human, 1-41 Amide) is a precursor molecule of the Endothelin-3 (ET-3) peptide, that belongs to the large family of endothelin peptides which activate the G-protein coupled receptors ETA and ETB. However ET-3 has lower affinity for the ETA receptors compared to Endothelin-1 (ET-1) and Endothelin-2 (ET-2), whereas all three endothelins have similar affinity for ETB receptors. As ETB receptors make up around 90% of the endothelin receptors found in the cerebral cortex in humans, ET-3 can be nicknamed the ‘brain endothelin’. Also through ET-3’s activation of ETB receptors, ET-3 is involved in the development of the enteric nervous system which controls within the gut, blood flow, secretion and intestinal motility. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.
Chemische Eigenschaften
Molekulargewicht:4,923.65 g/mol
Formel:C223H322N56O63S4
Reinheit:Min. 95%
Technische Anfrage zu: Big Endothelin-3 (Human, 1-41 Amide) Acetate
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.