Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
CAS: 159002-68-3
Ref. 3D-PGL-3826-PI
1mg | 1.007,00 € | ||
5mg | 3.783,00 € |
Produktinformation
- Oxm (Human, Mouse, Rat)
- Oxyntomodulin (Human, Mouse, Rat)
- Preproglucagon (53-89) (Human, Mouse, Rat)
- Proglucagon (33-69) (Human, Mouse, Rat)
- H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala-Oh
Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form.
One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Chemische Eigenschaften
Technische Anfrage zu: 3D-PGL-3826-PI Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat)
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.