H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH
Ref. 3D-PP42450
1mg | 642,00 € | ||
10mg | 755,00 € | ||
100mg | 1.571,00 € |
Produktinformation
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH include the following: Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased agonist at the GLP-1 N Al-Zamel, S Al-Sabah , Y Luqmani, L Adi - International journal of , 2020 - mdpi.comhttps://www.mdpi.com/1422-0067/21/9/3357 Study on gastric inhibitory polypeptide: Synthesis and properties C Dafu, C Hengran, X Minghua, C Huiting - Acta Biochimica et , 1994 - europepmc.orghttps://europepmc.org/article/cba/272803
Chemische Eigenschaften
Technische Anfrage zu: 3D-PP42450 H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.