
Cecropin A
Ref. 3D-PP44392
1mg
242,00€
10mg
284,00€
100mg
460,00€

Produktinformation
Name:Cecropin A
Synonyme:
- H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-
Marke:Biosynth
Beschreibung:Cecropin A is an antimicrobial peptide active against Gram-positive and Gram-negative bacteria.
Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains.
Besides its well-known antimicrobial properties, studies have demonstrated tumoricidal activity of cecropin A against leukemia, lymphoma, colon carcinoma cell lines and other tumour cell lines.
Furthermore, Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.
Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains.
Besides its well-known antimicrobial properties, studies have demonstrated tumoricidal activity of cecropin A against leukemia, lymphoma, colon carcinoma cell lines and other tumour cell lines.
Furthermore, Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.
Hinweis:Unsere Produkte sind nur für Laborzwecke. Für jede andere Verwendung, bitte melden sie sich bei uns.
Chemische Eigenschaften
Molekulargewicht:4,003.87 g/mol
Formel:C184H313N53O46
Technische Anfrage zu: Cecropin A
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern
Bitte verwenden Sie stattdessen den Warenkorb, um ein Angebot oder eine Bestellung anzufordern. Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.