H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Ref. 3D-PP47702
| Unbestimmte Größe | Nachfragen |
Produktinformation
Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice. Recent citations using H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH include the following: Review of a current role of mass spectrometry for proteome research CHW Chen - Analytica chimica acta, 2008 - Elsevierhttps://www.sciencedirect.com/science/article/pii/S000326700801132X Mass spectrometry for high-throughput proteome analysis and biomarker discovery CH Chen - Hiroshima Conference on Education and Science in - hiroshima-u.ac.jphttps://www.hiroshima-u.ac.jp/system/files/58163/5thHC_Proceedings.pdf#page=69
Chemische Eigenschaften
Technische Anfrage zu: 3D-PP47702 H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
Wenn Sie ein Angebot anfordern oder eine Bestellung aufgeben möchten, legen Sie stattdessen die gewünschten Produkte in Ihren Warenkorb und fordern Sie dann ein Angebot oder eine Bestellung an aus dem Warenkorb. Es ist schneller, billiger und Sie können von den verfügbaren Rabatten und anderen Vorteilen profitieren.
